ACY1 Polyclonal antibody

• 

  WB analysis using 11316-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11316-1-AP (Aminoacylase 1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11316-1-AP

  WB result of ACY1 antibody (11316-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACY1 transfected HepG2 cells.

• 

  IHC staining of human prostate cancer using 11316-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11316-1-AP (Aminoacylase 1 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 11316-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11316-1-AP (Aminoacylase 1 antibody at dilution of 1:50 (under 40x lens).

ACY1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11316-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ACY 1, ACY-1, aminoacylase 1, Aminoacylase-1, EC:3.5.1.14

---

Tested Applications

• Positive WB detected in: K-562 cells, HepG2 cells, PC-3 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11316-1-AP targets ACY1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1813

  Product name: Recombinant human ACY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-408 aa of BC014112

  Sequence: RGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

• Full Name: aminoacylase 1
• Calculated Molecular Weight: 40.8 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC014112
• Gene Symbol: ACY1
• Gene ID (NCBI): 95
• RRID: AB_2877757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03154
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aminoacylase 1 (ACY1) is a cytosolic enzyme that is widely distributed in mammalian tissues and catalyzes the hydrolysis of acylated amino acids into amino acids and acyl groups. The main functions of ACY1 are to accelerate the hydrolysis of N-acetylated peptides, especially N-acetylated neutral aliphatic amino acids, and participate in protein synthesis and turnover through the release of free amino acids.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Heliyon; FYN-mediated phosphorylation of BCKDK at Y151 promotes GBM proliferation by increasing the oncogenic metabolite N-acetyl-L-alanine; Authors - Ling Zou