ADAM17 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ADAM17 Monoclonal antibody (68725-1-Ig)

ADAM17 Monoclonal Antibody for WB, ELISA

Cat No. 68725-1-Ig

Clone No.2F4C2

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse and More (1)

Applications

WB, ELISA

Synonyms

ADAM 17, ADAM17, CD156b, cSVP, Snake venom like protease, TACE, TNF alpha convertase, TNF alpha converting enzyme

• 

  WB analysis using 68725-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68725-1-Ig (ADAM17 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68725-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68725-1-Ig (ADAM17 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: U2OS cells, NIH/3T3 cells, Calu-3 cells, A549 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68725-1-Ig targets ADAM17 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34022

  Product name: Recombinant human ADAM17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 693-824 aa of BC136783

  Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

• Full Name: ADAM metallopeptidase domain 17
• Calculated Molecular Weight: 824 aa, 93 kDa
• Observed Molecular Weight: 90-110 kDa
• GenBank Accession Number: BC136783
• Gene Symbol: ADAM17
• Gene ID (NCBI): 6868
• RRID: AB_3670417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78536
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Invest New Drugs; Crocetin suppresses colorectal cancer progression by targeting TGM2 and inhibiting the JAK2/STAT3 pathway.; Authors - Shuo Chen
human	WB	Res Sq; ADAM17 is an HIV-1 Restriction Factor Antagonized by Nef.; Authors - Yong-Hui Zheng