Tested Applications
Positive WB detected in | U2OS cells, NIH/3T3 cells, Calu-3 cells, A549 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
68725-1-Ig targets ADAM17 in WB, ELISA applications and shows reactivity with Human, Mouse samples.
Tested Reactivity | Human, Mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag34022 Product name: Recombinant human ADAM17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species |
Full Name | ADAM metallopeptidase domain 17 |
Calculated Molecular Weight | 824 aa, 93 kDa |
Observed Molecular Weight | 90-110 kDa |
GenBank Accession Number | BC136783 |
Gene Symbol | ADAM17 |
Gene ID (NCBI) | 6868 |
RRID | AB_3670417 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P78536 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ADAM17 antibody 68725-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |