ADAM21 Polyclonal antibody

• 

  WB analysis using 21434-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21434-1-AP (ADAM21 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ADAM21 Polyclonal Antibody for WB, ELISA

Cat No. 21434-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ADAM 21, Disintegrin and metalloproteinase domain-containing protein 21, EC:3.4.24.-

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21434-1-AP targets ADAM21 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16042

  Product name: Recombinant human ADAM21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 244-408 aa of BC109024

  Sequence: SMYQQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFSQWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQHDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKR

• Full Name: ADAM metallopeptidase domain 21
• Calculated Molecular Weight: 722 aa, 81 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC109024
• Gene Symbol: ADAM21
• Gene ID (NCBI): 8747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM21 is also present in growing axonal tracts during postnatal development and in growing primary olfactory axons in adults. In the olfactory nerve layer, ADAM21 often, but not always, colocalizes with OMP, a marker of mature olfactory neurons, but is not colocalized with the immature marker βIII-tubulin. The exclusive expression of ADAM21 in human testis and its sequence similarity with the fertilins suggest that it is also expressed on sperm cells and involved in sperm maturation and/or fertilization(PMID:9469942).