Product Information
84476-6-PBS targets ADAMTS2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34957 Product name: Recombinant human ADAMTS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1091-1211 aa of NM_014244 Sequence: KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF Predict reactive species |
| Full Name | ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| Calculated Molecular Weight | 135 kDa |
| Observed Molecular Weight | 110~130 kDa |
| GenBank Accession Number | NM_014244 |
| Gene Symbol | ADAMTS2 |
| Gene ID (NCBI) | 9509 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O95450 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
A disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) is a metalloproteinase that plays a key role in the processing of fibrillar procollagen precursors into mature collagen molecules by excising the amino-propeptide. ADAMTS-2 can, like the procollagen C-proteinases, be regulated by transforming growth factor-β1 (TGF-β1), with implications for mechanisms whereby this growth factor effects net increases in formation of extracellular matrix. Mutations in the ADAMTS-2 gene cause dermatosparaxis in human (dermatosparactic type of Ehlers-Danlos syndrome, also known as Ehlers-Danlos syndrome type VIIC). Human ADAMTS-2 has eight potential sites for Asn-linked glycosylation and other mammals (PMID: 16046392, 12646579).
