ADARB1 Monoclonal antibody

ADARB1 Monoclonal Antibody for WB, ELISA
Cat No. 67764-1-Ig
Clone No.1H8G3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

ADAR2, ADAR2a, ADAR2a L1, ADAR2a L2, ADAR2a L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, ADARB1, DRABA2, DRADA2, dsRNA adenosine deaminase, RED1, RNA editing deaminase 1, RNA editing enzyme 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected in4T1 cells, HeLa cells, HSC-T6 cells, HepG2 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67764-1-Ig targets ADARB1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17852

Product name: Recombinant human ADARB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 176-392 aa of BC065545

Sequence: LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND

Predict reactive species
Full Name adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
Calculated Molecular Weight 741 aa, 81 kDa
Observed Molecular Weight70 kDa, 80 kDa
GenBank Accession NumberBC065545
Gene Symbol ADARB1
Gene ID (NCBI) 104
RRIDAB_2918531
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP78563
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADARB1 (Double-stranded RNA-specific editase 1) is also named as ADAR2, DRADA2, RED1 and belongs to the ADAR family. It catalyses the deamination of adenosine to inosine at the GluR2 Q/R site in the pre-mRNA encoding the critical subunit of AMPA receptors. This protein has some isoforms with the molecular weight from 77 kDa to 81 kDa and 7 kDa, but it can be detected a very strong band at 50 kDa in addition to a predicted band at 75 kDa as the result of western blot, while ADARB1 has several alternative splice variants (PMID:23103828).

Protocols

Product Specific Protocols
WB protocol for ADARB1 antibody 67764-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...