ADARB1 Monoclonal antibody

• 

  WB analysis using 67764-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67764-1-Ig (ADARB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67764-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67764-1-Ig (ADARB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67764-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67764-1-Ig (ADARB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ADARB1 Monoclonal Antibody for WB, ELISA

Cat No. 67764-1-Ig

Clone No.1H8G3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

Synonyms

ADAR2, ADAR2a, ADAR2a L1, ADAR2a L2, ADAR2a L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, ADARB1, DRABA2, DRADA2, dsRNA adenosine deaminase, RED1, RNA editing deaminase 1, RNA editing enzyme 1

---

Tested Applications

• Positive WB detected in: 4T1 cells, HeLa cells, HSC-T6 cells, HepG2 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67764-1-Ig targets ADARB1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17852

  Product name: Recombinant human ADARB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 176-392 aa of BC065545

  Sequence: LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND

• Full Name: adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
• Calculated Molecular Weight: 741 aa, 81 kDa
• Observed Molecular Weight: 70 kDa, 80 kDa
• GenBank Accession Number: BC065545
• Gene Symbol: ADARB1
• Gene ID (NCBI): 104
• RRID: AB_2918531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78563
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADARB1 (Double-stranded RNA-specific editase 1) is also named as ADAR2, DRADA2, RED1 and belongs to the ADAR family. It catalyses the deamination of adenosine to inosine at the GluR2 Q/R site in the pre-mRNA encoding the critical subunit of AMPA receptors. This protein has some isoforms with the molecular weight from 77 kDa to 81 kDa and 7 kDa, but it can be detected a very strong band at 50 kDa in addition to a predicted band at 75 kDa as the result of western blot, while ADARB1 has several alternative splice variants (PMID:23103828).