Tested Applications
| Positive WB detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30171-1-AP targets ADCY8 in WB, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32901 Product name: Recombinant human ADCY8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 561-715 aa of NM_001115 Sequence: GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN Predict reactive species |
| Full Name | adenylate cyclase 8 (brain) |
| Calculated Molecular Weight | 140kd |
| Observed Molecular Weight | 140-150 kDa |
| GenBank Accession Number | NM_001115 |
| Gene Symbol | ADCY8 |
| Gene ID (NCBI) | 114 |
| RRID | AB_2935523 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40145 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADCY8 Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence. The antibody is specific to ADCY8.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ADCY8 antibody 30171-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

