ADCY8 Polyclonal antibody

ADCY8 Polyclonal Antibody for WB, ELISA
Cat No. 30171-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

AC8, ADCY3, ADCY8, adenylate cyclase 8 (brain), Adenylate cyclase type 8, Adenylate cyclase type VIII, Adenylyl cyclase 8, ATP pyrophosphate lyase 8, HBAC1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30171-1-AP targets ADCY8 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32901

Product name: Recombinant human ADCY8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 561-715 aa of NM_001115

Sequence: GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN

Predict reactive species
Full Name adenylate cyclase 8 (brain)
Calculated Molecular Weight140kd
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberNM_001115
Gene Symbol ADCY8
Gene ID (NCBI) 114
RRIDAB_2935523
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40145
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADCY8 Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence. The antibody is specific to ADCY8.

Protocols

Product Specific Protocols
WB protocol for ADCY8 antibody 30171-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...