Tested Applications
Positive WB detected in | HeLa cells, A549 cells, HEK-293 cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
23425-1-AP targets ADH7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19340 Product name: Recombinant human ADH7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 253-349 aa of BC131512 Sequence: ISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLA Predict reactive species |
Full Name | alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide |
Calculated Molecular Weight | 386 aa, 41 kDa |
Observed Molecular Weight | 45-47 kDa |
GenBank Accession Number | BC131512 |
Gene Symbol | ADH7 |
Gene ID (NCBI) | 131 |
RRID | AB_2879277 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P40394 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADH7(Alcohol dehydrogenase class 4 mu/sigma chain) is also named as gastric alcohol dehydrogenase, retinol dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. The ubiquitous expression pattern of ADH7 during embryogenesis has led to the notion that the enzymatic conversion of retinol to retinal occurs more or less uniformly and plays no role in the spatial or temporal regulation of RA synthesis during embryonic development(PMID:17473173). It has 2 isoforms produced by alternative splicing and can exsit as a homodimer(PMID:18479436).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ADH7 antibody 23425-1-AP | Download protocol |
IHC protocol for ADH7 antibody 23425-1-AP | Download protocol |
IF protocol for ADH7 antibody 23425-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |