Adiponectin Polyclonal antibody

Adiponectin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21613-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

ADIPOQ, apM-1, ADIPQTL1, Adipocyte, C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma, NIH/3T3 cells, 3T3-L1 cells
Positive IHC detected inrat brown adipose tissue, human placenta tissue, human prostate cancer tissue, human skin tissue, mouse brown adipose tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected in3T3-L1 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21613-1-AP targets Adiponectin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, sheep, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16304

Product name: Recombinant human ADIPOQ protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-244 aa of BC096308

Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Predict reactive species
Full Name adiponectin, C1Q and collagen domain containing
Calculated Molecular Weight 244 aa, 26 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC096308
Gene Symbol Adiponectin
Gene ID (NCBI) 9370
RRIDAB_2878891
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15848
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors.

Protocols

Product Specific Protocols
IF protocol for Adiponectin antibody 21613-1-APDownload protocol
IHC protocol for Adiponectin antibody 21613-1-APDownload protocol
WB protocol for Adiponectin antibody 21613-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Diabetes

PRMT4 Facilitates White Adipose Tissue Browning and Thermogenesis by Methylating PPARγ

Authors - Yi Zhong
humanWB

Int J Mol Sci

Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells.

Authors - Weiyun Zhang
mouseWB

Respir Res

Isthmin-1 attenuates allergic Asthma by stimulating adiponectin expression and alveolar macrophage efferocytosis in mice

Authors - Jong Huat Tee
mouseWB

J Nutr Biochem

All-trans retinoic acid induces lipophagy through the activation of the AMPK-Beclin1 signaling pathway and reduces Rubicon expression in adipocytes

Authors - Yuki Mori
humanWB, IF

Sci China Life Sci

Compression loading of osteoclasts attenuated microRNA-146a-5p expression, which promotes angiogenesis by targeting adiponectin.

Authors - Yue Wang
mouseWB

Dig Dis Sci

Adiponectin Alleviates Intestinal Fibrosis by Enhancing AMP-Activated Protein Kinase Phosphorylation.

Authors - Minghao Xie
Loading...
||
New chat

Able

正在加载,请稍候...