Recombinant human ADIPOR2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag5744
Synonyms
ADIPOR2, ACDCR2, adiponectin receptor 2, Adiponectin receptor protein 2, ADIPOR1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
(1-147 aa encoded by BC051858) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
