ADORA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85779-1-RR (same clone as 85779-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85779-1-RR (ADORA1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85779-1-PBS in a different storage buffer formulation.

ADORA1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85779-1-PBS

Clone No.242815A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

adenosine A1 receptor, Adenosine receptor A1, RDC7

---

Product Information

85779-1-PBS targets ADORA1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14092

  Product name: Recombinant human ADORA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-243 aa of BC026340

  Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF

• Full Name: adenosine A1 receptor
• Calculated Molecular Weight: 326 aa, 37 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC026340
• Gene Symbol: Adenosine A1 Receptor
• Gene ID (NCBI): 134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30542
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADORA1, also known as RDC7, is a receptor for adenosine. It is mediated by G proteins, which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.