Tested Applications
| Positive WB detected in | A549 cells, PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85779-1-RR targets ADORA1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species |
| Full Name | adenosine A1 receptor |
| Calculated Molecular Weight | 326 aa, 37 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC026340 |
| Gene Symbol | Adenosine A1 Receptor |
| Gene ID (NCBI) | 134 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P30542 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADORA1, also known as RDC7, is a receptor for adenosine. It is mediated by G proteins, which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ADORA1 antibody 85779-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

