ADORA2A Polyclonal antibody

• 

ADORA2A Polyclonal Antibody for ELISA

Cat No. 17059-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

adenosine A2a receptor, Adenosine receptor A2a, ADORA2, ADORA2A, hA2aR, RDC8

---

Product Information

17059-1-AP targets ADORA2A in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10781

  Product name: Recombinant human ADORA2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-412 aa of BC013780

  Sequence: YRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

• Full Name: adenosine A2a receptor
• Calculated Molecular Weight: 412 aa, 45 kDa
• GenBank Accession Number: BC013780
• Gene Symbol: ADORA2A
• Gene ID (NCBI): 135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29274
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.