Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 2 publications below |
Product Information
51092-1-AP targets ADORA2A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0470 Product name: Recombinant human ADORA2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-412 aa of BC013780 Sequence: RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Predict reactive species |
Full Name | adenosine A2a receptor |
Calculated Molecular Weight | 412 aa, 45 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | BC013780 |
Gene Symbol | ADORA2A |
Gene ID (NCBI) | 135 |
RRID | AB_2881245 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P29274 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Adenosine (ADO) is a retaliatory metabolite that is expressed in conditions of injury or stress. Its physiological functions are mediated through interaction with four specific transmembrane receptors called ADORA1, ADORA2A, ADORA2B, and ADORA3 (PMID:23994158). ADORA2A (adenosine A2A receptor) has been shown to dampen inflammatory responses. ADORA2A signaling has been discovered on polymorphonuclear neutrophils (PMNs) (PMID:36009485).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ADORA2A antibody 51092-1-AP | Download protocol |
IHC protocol for ADORA2A antibody 51092-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Neurobiol Ketamine counteracts sevoflurane-induced depressive-like behavior and synaptic plasticity impairments through the adenosine A2A receptor/ERK pathway in rats | ||
Pediatr Res Caffeine treatment started before injury reduces hypoxic-ischemic white-matter damage in neonatal rats by regulating phenotypic microglia polarization. | ||
Ophthalmic Res 7-Methylxanthine Influences the Behavior of ADORA2A-DRD2 Heterodimers in Human Retinal Pigment Epithelial Cells. | ||
Adv Sci (Weinh) Targeting the Negative Feedback of Adenosine-A2AR Metabolic Pathway by a Tailored Nanoinhibitor for Photothermal Immunotherapy. | ||
J Pharm Anal Inosine: a broad-spectrum anti-inflammatory against SARS-CoV-2 infection-induced acute lung injury via suppressing TBK1 phosphorylation | ||
Sci Bull (Beijing) Purinergic signaling by TCRαβ+ double-negative T regulatory cells ameliorates liver ischemia-reperfusion injury |