Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 2 publications below |
Product Information
51092-1-AP targets ADORA2A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0470 Product name: Recombinant human ADORA2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-412 aa of BC013780 Sequence: RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Predict reactive species |
| Full Name | adenosine A2a receptor |
| Calculated Molecular Weight | 412 aa, 45 kDa |
| Observed Molecular Weight | 38 kDa, 40-45 kDa |
| GenBank Accession Number | BC013780 |
| Gene Symbol | ADORA2A |
| Gene ID (NCBI) | 135 |
| RRID | AB_2881245 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29274 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Adenosine (ADO) is a retaliatory metabolite that is expressed in conditions of injury or stress. Its physiological functions are mediated through interaction with four specific transmembrane receptors called ADORA1, ADORA2A, ADORA2B, and ADORA3 (PMID:23994158). ADORA2A (adenosine A2A receptor) has been shown to dampen inflammatory responses. ADORA2A signaling has been discovered on polymorphonuclear neutrophils (PMNs) (PMID:36009485).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ADORA2A antibody 51092-1-AP | Download protocol |
| WB protocol for ADORA2A antibody 51092-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Neurobiol Ketamine counteracts sevoflurane-induced depressive-like behavior and synaptic plasticity impairments through the adenosine A2A receptor/ERK pathway in rats | ||
Pediatr Res Caffeine treatment started before injury reduces hypoxic-ischemic white-matter damage in neonatal rats by regulating phenotypic microglia polarization. | ||
Ophthalmic Res 7-Methylxanthine Influences the Behavior of ADORA2A-DRD2 Heterodimers in Human Retinal Pigment Epithelial Cells. | ||
Adv Sci (Weinh) Targeting the Negative Feedback of Adenosine-A2AR Metabolic Pathway by a Tailored Nanoinhibitor for Photothermal Immunotherapy. | ||
Front Pediatr Analysis and comparisons of gene expression changes in patient- derived neurons from ROHHAD, CCHS, and PWS | ||
J Sex Med Adenosine relaxes vagina smooth muscle through the cyclic guanosine monophosphate- and cyclic guanosine monophosphate-dependent pathways |











