ADRB1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28323-1-AP (same clone as 28323-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28323-1-AP (ADRB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28323-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 28323-1-AP (same clone as 28323-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28323-1-AP (ADRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28323-1-PBS in a different storage buffer formulation.

ADRB1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28323-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ADRB1R, B1AR, Beta 1 adrenergic receptor

---

Product Information

28323-1-PBS targets ADRB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28223

  Product name: Recombinant human ADRB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-477 aa of NM_000684

  Sequence: MQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

• Full Name: adrenergic, beta-1-, receptor
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_000684
• Gene Symbol: ADRB1
• Gene ID (NCBI): 153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADRB1 (adrenergic receptor beta 1), a member of the G protein-coupled receptor (GPCR) superfamily, responds to catecholamine stimulation. ADRB1 is the predominant subtype expressed in the heart and mediates increases in inotropy and chronotropy when stimulated. ADRB1 mediates a wide range of cardiovascular physiological responses and has been of great interest to researchers as a therapeutic target for cardiovascular diseases. Moreover, three subtypes of ADRBs (ADRB1, ADRB2, and ADRB3) are encoded by three separate genes (PMID:16636683; 33372534; 33593484).