Product Information
28323-1-PBS targets ADRB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28223 Product name: Recombinant human ADRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 388-477 aa of NM_000684 Sequence: MQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV Predict reactive species |
Full Name | adrenergic, beta-1-, receptor |
Calculated Molecular Weight | 51 kDa |
Observed Molecular Weight | 49 kDa |
GenBank Accession Number | NM_000684 |
Gene Symbol | ADRB1 |
Gene ID (NCBI) | 153 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P08588 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ADRB1 (adrenergic receptor beta 1), a member of the G protein-coupled receptor (GPCR) superfamily, responds to catecholamine stimulation. ADRB1 is the predominant subtype expressed in the heart and mediates increases in inotropy and chronotropy when stimulated. ADRB1 mediates a wide range of cardiovascular physiological responses and has been of great interest to researchers as a therapeutic target for cardiovascular diseases. Moreover, three subtypes of ADRBs (ADRB1, ADRB2, and ADRB3) are encoded by three separate genes (PMID:16636683; 33372534; 33593484).