ADRB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADRB1 Polyclonal antibody (28323-1-AP)

ADRB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28323-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ADRB1R, B1AR, Beta 1 adrenergic receptor

• 

  WB analysis using 28323-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28323-1-AP (ADRB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 28323-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28323-1-AP (ADRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ADRB1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28323-1-AP targets ADRB1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28223

  Product name: Recombinant human ADRB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-477 aa of NM_000684

  Sequence: MQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

• Full Name: adrenergic, beta-1-, receptor
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_000684
• Gene Symbol: ADRB1
• Gene ID (NCBI): 153
• RRID: AB_3086044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08588
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADRB1 (adrenergic receptor beta 1), a member of the G protein-coupled receptor (GPCR) superfamily, responds to catecholamine stimulation. ADRB1 is the predominant subtype expressed in the heart and mediates increases in inotropy and chronotropy when stimulated. ADRB1 mediates a wide range of cardiovascular physiological responses and has been of great interest to researchers as a therapeutic target for cardiovascular diseases. Moreover, three subtypes of ADRBs (ADRB1, ADRB2, and ADRB3) are encoded by three separate genes (PMID:16636683; 33372534; 33593484).

Publications

What published studies show

The ADRB1 Polyclonal antibody (Cat# 28323-1-AP) has 12 citations published in journals including Advanced Science, Aging Cell, International Journal of Oncology, Food & Function, Communications Biology, iScience, Journal of Pharmaceutical and Biomedical Analysis, Brain Research, Intensive Care Medicine Experimental, and Oncology Letters. Research fields span cardiovascular disease, cancer (breast, renal, hepatic), neurodegeneration, reproductive biology, stress physiology, bone homeostasis, intestinal regeneration, and pharmacology.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse	WB,IF	Adv Sci (Weinh); Norepinephrine Induces Sertoli Cell Ferroptosis via Receptors Desensitization Causing Stress-Related Male Reproductive Dysfunction.; Authors - Lingyu Zhang
mouse	WB	Adv Sci (Weinh); Targeting the E Prostanoid Receptor EP4 Mitigates Cardiac Fibrosis Induced by β-Adrenergic Activation; Authors - Hu Xu
mouse,human	IHC	Adv Sci (Weinh); Chronic Stress-Induced and Tumor Derived SP1+ Exosomes Polarizing IL-1β+ Neutrophils to Increase Lung Metastasis of Breast Cancer; Authors - Leyi Zhang
mouse	WB	Aging Cell; Aerobic Exercise Attenuates Autophagy-Lysosomal Flux Deficits via β2-AR-Mediated ESCRT-III Subunit CHMP4B in Mice With Human MAPT P301L; Authors - Shu-Guang Bi
		Int J Oncol; Stress‑induced catecholamines attenuate sorafenib efficacy by inhibiting ferroptosis in β2‑adrenergic receptor positive renal cell carcinoma.; Authors - Masaki Ushijima
		Food Funct; Folic acid enhances intestinal stem cell-mediated epithelial regeneration depending on β-adrenergic receptor signaling.; Authors - Yi Zheng