ADRB2 Polyclonal antibody

• 

  WB analysis using 29864-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 29864-1-AP (ADRB2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29864-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 29864-1-AP (ADRB2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse stomach using 29864-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using ADRB2 antibody (29864-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ADRB2 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 29864-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

ADRB2R, ADRBR, B2AR, BAR, Beta 2 adrenergic receptor

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IF-P detected in: mouse stomach tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

29864-1-AP targets ADRB2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32313

  Product name: Recombinant human ADRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-413 aa of BC012481

  Sequence: PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL

• Full Name: adrenergic, beta-2-, receptor, surface
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46-48 kDa
• GenBank Accession Number: BC012481
• Gene Symbol: ADRB2
• Gene ID (NCBI): 154
• RRID: AB_2923616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07550
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity, and type 2 diabetes. This antibody detects ADRB2 with a molecular weight of 46-48 kDa as has been shown by some researches (PMID: 30542705; 35075132).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	iScience; Region-specific sympatho-adrenergic regulation of specialized vasculature in bone homeostasis and regeneration; Authors - Hao-Kun Xu
human	WB	Oncol Lett; β‑adrenergic receptor activation promotes the proliferation of HepG2 cells via the ERK1/2/CREB pathways; Authors - Xingcheng Lin
	WB	Nat Cell Biol; Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA; Authors - Ziming Chen
mouse	WB	Immunobiology; Exploring liquid-liquid phase separation-related diagnostic biomarkers in osteoarthritis based on machine learning algorithms and experiment; Authors - Bo Dong
human	WB	Front Pharmacol; Gut microbiota-derived metabolite phenylacetylglutamine inhibits the progression of prostate cancer by suppressing the Wnt/β-catenin signaling pathway; Authors - Jing Lv
mouse	IF	J Immunother Cancer; ADRB2 inhibition suppresses cancer immune evasion by regulating tumor SOX10-PD-L1 axis and T cell function; Authors - Yu Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Elham (Verified Customer) (11-24-2025)

3% BSA for 30m, followed by overnight incubation with DBR2 antibody 1:100 dilution. Con Secondary Alex Fluor 488 1:400 dilution for 40m at room temperature

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: human airway smooth muscle cells

ADRB2 Antibody Immunofluorescence validation (1:100 dilution) in human airway smooth muscle cells (Cat no:29864-1-AP)