ADRB3 Polyclonal antibody, PBS Only

• 

  WB analysis using 30713-1-AP (same clone as 30713-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30713-1-AP (ADRB3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30713-1-PBS in a different storage buffer formulation.

ADRB3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30713-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30713-1-PBS targets ADRB3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31466

  Product name: Recombinant human ADRB3 protein

  Source: e coli.-derived, pet43.1a

  Tag: NUS+HIS

  Domain: 179-292 aa of NM_000025

  Sequence: RVGADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPARLLPLREHRALC

• Full Name: adrenergic, beta-3-, receptor
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44-50 kDa
• GenBank Accession Number: NM_000025
• Gene Symbol: ADRB3
• Gene ID (NCBI): 155
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13945
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-3 adrenergic receptor(ADRB3), a member of the G-protein-coupled receptor family, is expressed mainly in adipose tissue and is thought to contribute to lipolysis and thermogenesis. In addition, the overexpression of ADRB3 has been found in several cancer types, including breast cancer, gallbladder cancer , and colorectal cancer. More recently, the involvement of ADRB3 in the metabolic reprogramming of melanoma, the promotion of immune tolerance, and the regulation of cancer differentiation have been described. (PMID: 32514619)