Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GRK2 Polyclonal antibody

GRK2 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 13990-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, FC (Intra), IP, CoIP, ELISA

ADRBK1, ARBK1, BARK, BARK1, Beta ARK 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, THP-1 cells, Jurkat cells
Positive IP detected inHL-60 cells
Positive IHC detected inhuman lymphoma tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13990-1-AP targets GRK2 in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5071

Product name: Recombinant human ADRBK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 390-689 aa of BC037963

Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

Predict reactive species
Full Name adrenergic, beta, receptor kinase 1
Calculated Molecular Weight 689 aa, 80 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC037963
Gene Symbol ADRBK1
Gene ID (NCBI) 156
RRIDAB_2225833
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25098
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRK2 (G-protein coupled receptor kinase 2) is also named as ADRBK1 (Beta-adrenergic receptor kinase 1), BARK, and BARK1. G-protein-coupled receptors (GPCRs) transmit extracellular signals across the cell membrane. GPCR kinases (GRKs) desensitize GPCR signals in the cell membrane. GRK2 translocation from the cytoplasm to the cell membrane in response to extracellular signals is critical to the function of the protein, where GRK phosphorylation is an important component of its translocation to the membrane.(PMID:27412951)

Protocols

Product Specific Protocols
FC protocol for GRK2 antibody 13990-1-APDownload protocol
IHC protocol for GRK2 antibody 13990-1-APDownload protocol
IP protocol for GRK2 antibody 13990-1-APDownload protocol
WB protocol for GRK2 antibody 13990-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Nat Commun

Phospho-selective mechanisms of arrestin conformations and functions revealed by unnatural amino acid incorporation and (19)F-NMR.

Authors - Fan Yang
  • KD Validated
humanWB

Nat Commun

Neddylation inhibition induces glutamine uptake and metabolism by targeting CRL3SPOP E3 ligase in cancer cells.

Authors - Qiyin Zhou
mouse,humanWB,CoIP

J Pharm Anal

Monoclonal antibody targeting mu-opioid receptor attenuates morphine tolerance via enhancing morphine-induced receptor endocytosis

Authors - Jia-Jia Zhang
  • KD Validated
mouseWB,IP

Acta Pharmacol Sin

GRK2-mediated phosphorylation and de-succinylation of PKM2 reduce macrophage glycolysis in rheumatoid arthritis

Authors - Xue-Zhi Yang
humanWB

Proc Natl Acad Sci U S A

α-fluoro-β-alanine functions as a β-arrestin1-biased ligand of S1PR2 to upregulate DPD expression in cancer cells

Authors - Mingyong Tan
humanWB

Oncogene

β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma.

Authors - Yanwei Lu

Reviews

    2.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Charlotte (Verified Customer) (07-23-2024)

I tested the antibody as followed: Blocking 1h in 5% milk in TBST 1/1000 in blocking solution, O.N. at 4°C 5*5min TBST 1/5000 in blocking solution, 1h at RT° 4*5min PBST + 5min PBS in IMCD3 ; I obtained GRK2 signal (the middle band out of the 3) but also many aspecific bands. I also tested it in IF since I had it (the ab is not approved for this application) but I got no signal

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: IMCD3
GRK2 Antibody Western Blot,Immunofluorescence validation (1/1000 dilution) in IMCD3 (Cat no:13990-1-AP)

Franziska (Verified Customer) (09-11-2023)

Since there are no GRK-2 antibodies specific for C.elegans, I decided to try this one which didn't work very well, there was a lot of unspecific binding however, C.elegans was not mentioned as tested reactivity.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:750
  • Cell Tissue Type: C.elegans
GRK2 Antibody Western Blot validation (1:750 dilution) in C.elegans (Cat no:13990-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...