AFM Polyclonal antibody, PBS Only

• 

  WB analysis of human blood using 25280-1-AP (same clone as 25280-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 25280-1-AP (AFM Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25280-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human plasma using 25280-1-AP (same clone as 25280-1-PBS)

  IP result of anti-AFM (IP:25280-1-AP, 4ug; Detection:25280-1-AP 1:2000) with human plasma lysate 4000ug. This data was developed using the same antibody clone with 25280-1-PBS in a different storage buffer formulation.

AFM Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25280-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25280-1-PBS targets AFM in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16866

  Product name: Recombinant human AFM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-599 aa of BC109020

  Sequence: SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN

• Full Name: afamin
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC109020
• Gene Symbol: AFM
• Gene ID (NCBI): 173
• RRID: AB_2880005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43652
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AFM (Afamin) is a member of the albumin superfamily, which comprises albumin, vitamin D-binding protein, a-fetoprotein, and afamin. AFM is present in the plasma/serum, cerebrospinal fluid, and follicular fluid, and functions as a vitamin E-binding protein. Alterations of expression level of AFM have been linked to variety of diseases like cancer.