AFM Polyclonal antibody

• 

  WB analysis of human blood using 25280-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 25280-1-AP (AFM Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human plasma using 25280-1-AP

  IP result of anti-AFM (IP:25280-1-AP, 4ug; Detection:25280-1-AP 1:2000) with human plasma lysate 4000ug.

AFM Polyclonal Antibody for WB, IP, ELISA

Cat No. 25280-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IP, ELISA

Synonyms

afamin, AFM, ALB2, ALBA, ALF, Alpha Alb, Alpha albumin

---

Tested Applications

• Positive WB detected in: human blood tissue
• Positive IP detected in: human plasma tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25280-1-AP targets AFM in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16866

  Product name: Recombinant human AFM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-599 aa of BC109020

  Sequence: SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN

• Full Name: afamin
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC109020
• Gene Symbol: AFM
• Gene ID (NCBI): 173
• RRID: AB_2880005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43652
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AFM (Afamin) is a member of the albumin superfamily, which comprises albumin, vitamin D-binding protein, a-fetoprotein, and afamin. AFM is present in the plasma/serum, cerebrospinal fluid, and follicular fluid, and functions as a vitamin E-binding protein. Alterations of expression level of AFM have been linked to variety of diseases like cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Biomed Chromatogr; Revealing the mechanism of Gualou-Xiebai against myocardial ischemia based on network pharmacology and energy metabolism strategies; Authors - Qi Jiang