AFP Fusion Protein

Source

E. coli-derived, PET28a

Tag

6*His

Format

Liquid

Publications

1

Cat no : Ag6089

Synonyms

FETA; HPAFP



Product Information

Peptide Sequence LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
(260-609 aa encoded by BC027881)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.

Publications

SpeciesTitle

Biomed Environ Sci

Effects of Hypoxia on the Growth and Development of the Fetal Ovine Hepatocytes in Primary Culture.

Authors - Li Cao