Tested Applications
| Positive WB detected in | HepG2 cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27681-1-AP targets AGAP3 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26662 Product name: Recombinant human AGAP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 474-556 aa of BC044644 Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT Predict reactive species |
| Full Name | ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 |
| Calculated Molecular Weight | 95 kDa |
| Observed Molecular Weight | 95 kDa |
| GenBank Accession Number | BC044644 |
| Gene Symbol | AGAP3 |
| Gene ID (NCBI) | 116988 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96P47 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras/ERK signaling (PMID: 23904596).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AGAP3 antibody 27681-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

