AGRP Polyclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 21249-1-AP (same clone as 21249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21249-1-AP (AGRP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21249-1-AP (same clone as 21249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21249-1-AP (AGRP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus using 21249-1-AP (same clone as 21249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21249-1-AP (AGRP Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus using 21249-1-AP (same clone as 21249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21249-1-AP (AGRP Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21249-1-PBS in a different storage buffer formulation.

AGRP Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21249-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21249-1-PBS targets AGRP in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15752

  Product name: Recombinant human AGRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-132 aa of BC110443

  Sequence: GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

• Full Name: agouti related protein homolog (mouse)
• Calculated Molecular Weight: 132 aa, 14 kDa
• GenBank Accession Number: BC110443
• Gene Symbol: AGRP
• Gene ID (NCBI): 181
• RRID: AB_2878831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00253
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.