Tested Applications
| Positive IHC detected in | mouse brain tissue, human oesophagus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
21249-1-AP targets AGRP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15752 Product name: Recombinant human AGRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-132 aa of BC110443 Sequence: GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT Predict reactive species |
| Full Name | agouti related protein homolog (mouse) |
| Calculated Molecular Weight | 132 aa, 14 kDa |
| GenBank Accession Number | BC110443 |
| Gene Symbol | AGRP |
| Gene ID (NCBI) | 181 |
| RRID | AB_2878831 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Agouti-related peptide (AGRP) is a potent orexigenic neuropeptide synthesis-restricted to the hypothalamic arcuate nucleus. Functioning as an endogenous competitive antagonist of melanocortin receptors (MC3R and MC4R), it downregulates satiety pathways. Consequently, AGRP acts as a master regulator that drives hyperphagia, curtails energy expenditure, and maintains systemic metabolic homeostasis under caloric deficits. (PMID: 9311920; PMID: 10195157; PMID: 16158063; PMID: 21364278).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AGRP antibody 21249-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







