AGRP Polyclonal antibody

• 

  IHC staining of mouse brain using 21249-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21249-1-AP (AGRP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21249-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21249-1-AP (AGRP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus using 21249-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21249-1-AP (AGRP Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human oesophagus using 21249-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21249-1-AP (AGRP Antibody) at dilution of 1:200 (under 40x lens).

AGRP Polyclonal Antibody for IHC, ELISA

Cat No. 21249-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

Agouti related protein, AGRP, AGRT, ART, ASIP2, KNOTTIN

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, human oesophagus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21249-1-AP targets AGRP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15752

  Product name: Recombinant human AGRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-132 aa of BC110443

  Sequence: GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

• Full Name: agouti related protein homolog (mouse)
• Calculated Molecular Weight: 132 aa, 14 kDa
• GenBank Accession Number: BC110443
• Gene Symbol: AGRP
• Gene ID (NCBI): 181
• RRID: AB_2878831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00253
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Acupunct Med; Electroacupuncture alleviates insulin resistance and impacts the hypothalamic IRS-1/PI3K/AKT pathway and miRNA-29a-3p in a rat model of type 2 diabetes; Authors - Shuting Zhuang