• Featured Product
  • KD/KO Validated

AHR Monoclonal antibody

AHR Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 67785-1-Ig
Clone No.2D1F9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Class E basic helix-loop-helix protein 76, bHLHe76, Ah receptor, 2D1F9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, HSC-T6 cells, 4T1 cells, PC-3 cells, HeLa cells, Caco-2 cells, HepG2 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue, mouse testis tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67785-1-Ig targets AHR in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, zebrafish
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28935

Product name: Recombinant human AHR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-300 aa of BC070080

Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

Predict reactive species
Full Name aryl hydrocarbon receptor
Calculated Molecular Weight 848 aa, 96 kDa
Observed Molecular Weight105-110 kDa
GenBank Accession NumberBC070080
Gene Symbol AHR
Gene ID (NCBI) 196
RRIDAB_2918549
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35869
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)

Protocols

Product Specific Protocols
IF protocol for AHR antibody 67785-1-IgDownload protocol
IHC protocol for AHR antibody 67785-1-IgDownload protocol
WB protocol for AHR antibody 67785-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Phytother Res

Quercetin ameliorates ulcerative colitis by activating aryl hydrocarbon receptor to improve intestinal barrier integrity

Authors - Xiaojing Wang
mouseWB

NPJ Regen Med

Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration

Authors - Jingyi Shen

Cell Rep

Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription

Authors - Wen-Juan Li
mouseIF

Ecotoxicol Environ Saf

Hesperetin protects hippocampal neurons from the neurotoxicity of Aflatoxin B1 in mice

Authors - Chao Song
ratWB

Biomater Sci

Glioma-targeted multifunctional nanoparticles to co-deliver camptothecin and curcumin for enhanced chemo-immunotherapy.

Authors - Zian Wang
mouseWB,IF

iScience

StemRegenin 1 attenuates the RANKL-induced osteoclastogenesis via inhibiting AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway

Authors - Shengji Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rashmi (Verified Customer) (10-13-2025)

The antibody worked well (1:100 dilution) with IFA on paraffin-embedded mouse lung tissue.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Lung
AHR Antibody Immunofluorescence validation (1:100 dilution) in Lung (Cat no:67785-1-Ig)
FH

Bartosz (Verified Customer) (02-09-2023)

Perfect Abs, the bands are clear and very strong, even in case of small of amount of protein, loaded into gel (20 ug). Just perfect, highly recommend.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: SH-SY5Y cells; A549 cells; CACO-2 cells; BJ cells
Loading...
||
New chat Able
正在加载,请稍候...