AIF1L Polyclonal antibody

• 

  WB analysis using 31569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31569-1-AP (AIF1L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse kidney using 31569-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using AIF1L antibody (31569-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AIF1L Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 31569-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

IBA2, C9orf58

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31569-1-AP targets AIF1L in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36216

  Product name: Recombinant human AIF1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-69 aa of BC021253

  Sequence: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDL

• Full Name: allograft inflammatory factor 1-like
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC021253
• Gene Symbol: AIF1L
• Gene ID (NCBI): 83543
• RRID: AB_3670038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BQI0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AIF1L is a homolog to the allograft inflammatory factor 1 (AIF1 or IBA1), sharing up to 60% sequence homology. Previous work could demonstrate that AIF1L and AIF1 show actin bundling and cross-linking function, co-localization, and-sedimentation with F-actin. More recently, increased expression levels for AIF1L were reported in cases of breast cancer and functionally related to increased proliferation rates via upregulation of cyclin D1.