AIFM3 Polyclonal antibody

• 

  WB analysis using 14778-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14778-1-AP (AIFM3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 14778-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 14778-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14778-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14778-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AIFM3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14778-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:1.-.-.-, Apoptosis-inducing factor-like protein, Apoptosis-inducing factor 3, Apoptosis inducing factor 3, AIFL

---

Tested Applications

• Positive WB detected in: HEK-293 cells, U-87 MG cells
• Positive IHC detected in: human ovary tumor tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14778-1-AP targets AIFM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6278

  Product name: Recombinant human AIFM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 355-598 aa of BC032485

  Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 3
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC032485
• Gene Symbol: AIFM3
• Gene ID (NCBI): 150209
• RRID: AB_2258090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apoptosis-inducing factor, mitochondrion-associated 3 (AIFM3) is a mitochondrial protein/flavoenzyme and its gene is located on chromosome 22q11.21. Mature human AIFM3 protein consists of 598 amino acids with a molecular weight of 66 kDa and is predominantly localized in the mitochondria. AIFM3 is widely expressed in many tissues, and breast cancer tissues and cholangiocarcinoma tissue (PMID: 32664187).