AIFM3 Polyclonal antibody, PBS Only

• 

  WB analysis using 14778-1-AP (same clone as 14778-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14778-1-AP (AIFM3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14778-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 14778-1-AP (same clone as 14778-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14778-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 14778-1-AP (same clone as 14778-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14778-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14778-1-AP (same clone as 14778-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14778-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14778-1-AP (same clone as 14778-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 14778-1-AP (AIFM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14778-1-PBS in a different storage buffer formulation.

AIFM3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14778-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:1.-.-.-, Apoptosis-inducing factor-like protein, Apoptosis-inducing factor 3, Apoptosis inducing factor 3, AIFL

---

Product Information

14778-1-PBS targets AIFM3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6278

  Product name: Recombinant human AIFM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 355-598 aa of BC032485

  Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 3
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC032485
• Gene Symbol: AIFM3
• Gene ID (NCBI): 150209
• RRID: AB_2258090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NN9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apoptosis-inducing factor, mitochondrion-associated 3 (AIFM3) is a mitochondrial protein/flavoenzyme and its gene is located on chromosome 22q11.21. Mature human AIFM3 protein consists of 598 amino acids with a molecular weight of 66 kDa and is predominantly localized in the mitochondria. AIFM3 is widely expressed in many tissues, and breast cancer tissues and cholangiocarcinoma tissue (PMID: 32664187).