Tested Applications
Positive WB detected in | human brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human brain tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IF | See 1 publications below |
CoIP | See 1 publications below |
Product Information
12591-1-AP targets AKAP7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species |
Full Name | A kinase (PRKA) anchor protein 7 |
Calculated Molecular Weight | 81 aa, 9 kDa |
Observed Molecular Weight | 11 kDa, 18 kDa, 37 kDa |
GenBank Accession Number | BC016927 |
Gene Symbol | AKAP7 |
Gene ID (NCBI) | 9465 |
RRID | AB_2226037 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43687 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 15-18 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals. This antibody can recognize all the isoforms of AKAP7.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AKAP7 antibody 12591-1-AP | Download protocol |
IHC protocol for AKAP7 antibody 12591-1-AP | Download protocol |
IF protocol for AKAP7 antibody 12591-1-AP | Download protocol |
IP protocol for AKAP7 antibody 12591-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A Cardiomyocytes from AKAP7 knockout mice respond normally to adrenergic stimulation.
| ||
Elife Targeted deletion of AKAP7 in dentate granule cells impairs spatial discrimination.
| ||
MBio Murine AKAP7 Has a 2',5'-Phosphodiesterase Domain That Can Complement an Inactive Murine Coronavirus ns2 Gene. | ||
Clin Proteomics iTRAQ plasma proteomics analysis for candidate biomarkers of type 2 incipient diabetic nephropathy. | ||
Cardiovasc Res Remodelling of cAMP dynamics within the SERCA2a microdomain in heart failure with preserved ejection fraction caused by obesity and type 2 diabetes |