Tested Applications
| Positive WB detected in | human brain tissue |
| Positive IHC detected in | human brain tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12591-1-AP targets AKAP7 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species |
| Full Name | A kinase (PRKA) anchor protein 7 |
| Calculated Molecular Weight | 81 aa, 9 kDa |
| Observed Molecular Weight | 11 kDa, 18 kDa, 37 kDa |
| GenBank Accession Number | BC016927 |
| Gene Symbol | AKAP7 |
| Gene ID (NCBI) | 9465 |
| RRID | AB_2226037 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 9-15 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals. This antibody can recognize all the isoforms of AKAP7.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AKAP7 antibody 12591-1-AP | Download protocol |
| IHC protocol for AKAP7 antibody 12591-1-AP | Download protocol |
| WB protocol for AKAP7 antibody 12591-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AKAP7 antibody (Cat# 12591-1-AP) has 6 total citations spanning journals including Cardiovascular Research, PNAS, mBio, Clinical Proteomics, Discover Oncology, and eLife. Research fields covered include cardiovascular disease (heart failure, adrenergic signaling), virology (phosphodiesterase activity), metabolic disease (diabetic nephropathy proteomics), oncology (bladder carcinoma, ferroptosis), and neuroscience (spatial memory). Applications used include WB, CoIP, IF, and IHC in mouse and human samples.
| Species | Application | Title |
|---|---|---|
Cardiovasc Res Remodelling of cAMP dynamics within the SERCA2a microdomain in heart failure with preserved ejection fraction caused by obesity and type 2 diabetes | ||
Proc Natl Acad Sci U S A Cardiomyocytes from AKAP7 knockout mice respond normally to adrenergic stimulation.
| ||
MBio Murine AKAP7 Has a 2',5'-Phosphodiesterase Domain That Can Complement an Inactive Murine Coronavirus ns2 Gene. | ||
Clin Proteomics iTRAQ plasma proteomics analysis for candidate biomarkers of type 2 incipient diabetic nephropathy. | ||
Discov Oncol AKAP7 is a prognostic biomarker involved in immune infiltration of bladder urothelial carcinoma and correlated with ferroptosis. | ||
Elife Targeted deletion of AKAP7 in dentate granule cells impairs spatial discrimination.
|
