AKR1B1 Polyclonal antibody, PBS Only

• 

  WB analysis using 15439-1-AP (same clone as 15439-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15439-1-AP (AKR1B1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 15439-1-AP (same clone as 15439-1-PBS)

  WB result of AKR1B1 antibody (15439-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AKR1B1 transfected A431 cells. This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 15439-1-AP (same clone as 15439-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15439-1-AP (AKR1B1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 15439-1-AP (same clone as 15439-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15439-1-AP (AKR1B1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 15439-1-AP (same clone as 15439-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15439-1-AP (AKR1B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 15439-1-AP (same clone as 15439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15439-1-AP (AKR1B1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 15439-1-AP (same clone as 15439-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using AKR1B1 antibody (15439-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15439-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AKR1B1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15439-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AKR1B 1, Aldo-keto reductase family 1 member B1, ALDR1, ALR2, AR

---

Product Information

15439-1-PBS targets AKR1B1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7142

  Product name: Recombinant human AKR1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-316 aa of BC000260

  Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

• Full Name: aldo-keto reductase family 1, member B1 (aldose reductase)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000260
• Gene Symbol: AKR1B1
• Gene ID (NCBI): 231
• RRID: AB_2224154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15121
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.