Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 12 publications below |
| IHC | See 1 publications below |
Product Information
21641-1-AP targets AKT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16298 Product name: Recombinant human AKT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 95-155 aa of BC121154 Sequence: REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG Predict reactive species |
| Full Name | v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
| Calculated Molecular Weight | 465 aa, 54 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC121154 |
| Gene Symbol | AKT3 |
| Gene ID (NCBI) | 10000 |
| RRID | AB_10733649 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y243 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKT3, also named as PKBG, is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. AKT3 is a key modulator of several tumors like melanoma, glioma and ovarian cancer. Active AKT3 increases progressively during melanoma tumor progression with highest levels present in advanced-stage metastatic melanomas.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AKT3 antibody 21641-1-AP | Download protocol |
| WB protocol for AKT3 antibody 21641-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Oncol Long Non-coding RNA AK025387 Promotes Cell Migration and Invasion of Gastric Cancer. | ||
J Cell Mol Med EGR1 interacts with DNMT3L to inhibit the transcription of miR-195 and plays an anti-apoptotic role in the development of gastric cancer. | ||
Clin Epigenetics Alterations of DNA methylation were associated with the rapid growth of cortisol-producing adrenocortical adenoma during pregnancy. | ||
Cancer Cell Int NEK7 promotes gastric cancer progression as a cell proliferation regulator. | ||
Exp Hematol Oncol YTHDF1 promotes hepatocellular carcinoma progression via activating PI3K/AKT/mTOR signaling pathway and inducing epithelial-mesenchymal transition. |





