AKT3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85769-4-RR (same clone as 85769-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85769-4-RR (AKT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85769-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85769-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85769-4-RR against Human AKT3 were performed. The affinity constant is 0.696 nM.

AKT3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85769-4-PBS

Clone No.250046E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.11.1, PKB gamma, PKBG, PRKBG, Protein kinase Akt 3

---

Product Information

85769-4-PBS targets AKT3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16298

  Product name: Recombinant human AKT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 95-155 aa of BC121154

  Sequence: REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG

• Full Name: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
• Calculated Molecular Weight: 465 aa, 54 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC121154
• Gene Symbol: AKT3
• Gene ID (NCBI): 10000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AKT3, also named as PKBG, is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. AKT3 is a key modulator of several tumors like melanoma, glioma and ovarian cancer. Active AKT3 increases progressively during melanoma tumor progression with highest levels present in advanced-stage metastatic melanomas.