ALDH1A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALDH1A2 Polyclonal antibody (13951-1-AP)

• 

  WB analysis using 13951-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13951-1-AP (ALDH1A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 13951-1-AP

  IP result of anti-ALDH1A2 (IP:13951-1-AP, 4ug; Detection:13951-1-AP 1:6000) with K-562 cells lysate 2440 ug.

• 

  IHC staining of mouse ovary using 13951-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13951-1-AP (ALDH1A2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 13951-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13951-1-AP (ALDH1A2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 13951-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13951-1-AP (ALDH1A2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of K-562 using 13951-1-AP

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using ALDH1A2 antibody (13951-1-AP) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ALDH1A2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13951-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ALDH1A 2, EC:1.2.1.36, RALDH 2, RALDH(II), RalDH2

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse spleen tissue, mouse testis tissue, rat spleen tissue, rat testis tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IHC: See 5 publications below

Product Information

13951-1-AP targets ALDH1A2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5062

  Product name: Recombinant human ALDH1A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-481 aa of BC030589

  Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

• Full Name: aldehyde dehydrogenase 1 family, member A2
• Calculated Molecular Weight: 518 aa, 57 kDa
• Observed Molecular Weight: 53-57 kDa
• GenBank Accession Number: BC030589
• Gene Symbol: ALDH1A2
• Gene ID (NCBI): 8854
• RRID: AB_2224033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94788
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Neuron; A gain-of-function Retsat variant from high-altitude adaptation promotes myelination via a neuronal dihydroretinoic acid-RXR-γ pathway; Authors - Daopeng Li
human	WB	Clin Transl Med; Melatonin inhibits lipid accumulation to repress prostate cancer progression by mediating the epigenetic modification of CES1.; Authors - Lijie Zhou
human	WB	Elife; FAK activity sustains intrinsic and acquired ovarian cancer resistance to platinum chemotherapy.; Authors - Carlos J Diaz Osterman
human	WB	iScience; Modification of lysine-260 2-hydroxyisobutyrylation destabilizes ALDH1A1 expression to regulate bladder cancer progression; Authors - Zhilei Zhang
mouse	WB	J Nutr Biochem; All-trans retinoic acid induces lipophagy through the activation of the AMPK-Beclin1 signaling pathway and reduces Rubicon expression in adipocytes; Authors - Yuki Mori
human	WB	Am J Cancer Res; Inhibition of Na+/H+ exchanger (NHE) 7 by 5-(N-ethyl-N-isopropyl)-Amiloride displays anti-cancer activity in non-small cell lung cancer by disrupting cancer stem cell activity and downregulating PD-L1 expression; Authors - Bing-Yen Wang