ALDH1B1 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 22220-1-AP (same clone as 22220-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 22220-1-AP (same clone as 22220-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 22220-1-AP (same clone as 22220-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 22220-1-AP (same clone as 22220-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 22220-1-AP (same clone as 22220-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22220-1-AP (ALDH1B1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 22220-1-AP (ALDH1B1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22220-1-AP (same clone as 22220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 22220-1-AP (ALDH1B1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 22220-1-AP (same clone as 22220-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ALDH1B1 antibody (22220-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22220-1-AP (same clone as 22220-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ALDH1B1 antibody (22220-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 22220-1-PBS in a different storage buffer formulation.

ALDH1B1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22220-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, mitochondrial, ALDH5, ALDHX, EC:1.2.1.3

---

Product Information

22220-1-PBS targets ALDH1B1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17557

  Product name: Recombinant human ALDH1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-382 aa of BC001619

  Sequence: SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA

• Full Name: aldehyde dehydrogenase 1 family, member B1
• Calculated Molecular Weight: 517 aa, 57 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC001619
• Gene Symbol: ALDH1B1
• Gene ID (NCBI): 219
• RRID: AB_2879035
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30837
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1.