ALG9 Polyclonal antibody

• 

  WB analysis using 29218-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29218-1-AP (ALG9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 29218-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29218-1-AP (ALG9 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 29218-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29218-1-AP (ALG9 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ALG9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29218-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:2.4.1.259, Dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, DIBD1, Asparagine-linked glycosylation protein 9 homolog

---

Tested Applications

• Positive WB detected in: HL-60 cells, Jurkat cells, THP-1 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29218-1-AP targets ALG9 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30489

  Product name: Recombinant human ALG9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-582 aa of BC009255

  Sequence: EFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKL

• Full Name: asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae)
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC009255
• Gene Symbol: ALG9
• Gene ID (NCBI): 79796
• RRID: AB_3086105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6U8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALG9 encodes an endoplasmic reticulum enzyme that builds N-glycans, the third ER protein-encoding polycystic disease gene after GANAB and DNAJB11. Autosomal recessive loss of ALG9 results in a severe congenital disorder of glycosylation (CDG) with a multiorgan phenotype that includes kidney cysts (PMID: 31395617). Western blot analysis detected ALG9 at an apparent molecular mass of 70 kDa.