ALG9 Polyclonal antibody, PBS Only

• 

  WB analysis using 29218-1-AP (same clone as 29218-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29218-1-AP (ALG9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 29218-1-AP (same clone as 29218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29218-1-AP (ALG9 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 29218-1-AP (same clone as 29218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29218-1-AP (ALG9 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29218-1-PBS in a different storage buffer formulation.

ALG9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29218-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.4.1.259, Dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, DIBD1, Asparagine-linked glycosylation protein 9 homolog

---

Product Information

29218-1-PBS targets ALG9 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30489

  Product name: Recombinant human ALG9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-582 aa of BC009255

  Sequence: EFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKL

• Full Name: asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae)
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC009255
• Gene Symbol: ALG9
• Gene ID (NCBI): 79796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6U8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ALG9 encodes an endoplasmic reticulum enzyme that builds N-glycans, the third ER protein-encoding polycystic disease gene after GANAB and DNAJB11. Autosomal recessive loss of ALG9 results in a severe congenital disorder of glycosylation (CDG) with a multiorgan phenotype that includes kidney cysts (PMID: 31395617). Western blot analysis detected ALG9 at an apparent molecular mass of 70 kDa.