ALPI Recombinant monoclonal antibody

• 

  WB analysis of mouse small intestine using 86505-1-RR

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 86505-1-RR (ALPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat small intestine using 86505-1-RR

  rat small intestine tissue were subjected to SDS PAGE followed by western blot with 86505-1-RR (ALPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

ALPI Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86505-1-RR

Clone No.251267F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.1.3.1, IAP, Intestinal alkaline phosphatase, Intestinal-type alkaline phosphatase

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue, rat small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86505-1-RR targets ALPI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3033

  Product name: Recombinant Human ALPI protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-528 aa of NM_001631.5

  Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP

• Full Name: alkaline phosphatase, intestinal
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: NM_001631.5
• Gene Symbol: ALPI
• Gene ID (NCBI): 248
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Intestinal-type alkaline phosphatase (IAP) is one of the four human alkaline-phosphatase isoenzymes. It is synthesized by enterocytes of the small-intestinal brush border and is released into the gut lumen, blood and stool. Intestinal-type alkaline phosphatase is a constitutive, evolutionarily conserved sentinel that chemically disarms microbial toxins, orchestrates innate immunity and preserves gut homeostasis.