ALX1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse embryo using 16372-1-AP (same clone as 16372-1-PBS)

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 16372-1-AP (ALX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 16372-1-AP (same clone as 16372-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 16372-1-AP (ALX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16372-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ALX1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16372-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16372-1-PBS targets ALX1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9295

  Product name: Recombinant human ALX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-326 aa of BC010923

  Sequence: MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM

• Full Name: ALX homeobox 1
• Calculated Molecular Weight: 326 aa, 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC010923
• Gene Symbol: ALX1
• Gene ID (NCBI): 8092
• RRID: AB_2878249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15699
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.