Product Information
84891-6-PBS targets AMACR as part of a matched antibody pair:
MP01623-4: 84891-7-PBS capture and 84891-6-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg4005 Product name: Recombinant Human AMACR protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 200-330 aa of NM_014324.6 Sequence: KLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPL Predict reactive species |
Full Name | alpha-methylacyl-CoA racemase |
Calculated Molecular Weight | 42 kDa |
GenBank Accession Number | NM_014324.6 |
Gene Symbol | AMACR |
Gene ID (NCBI) | 23600 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9UHK6-1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |