AMACR Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01623-4

  Sandwich ELISA standard curve of MP01623-4, Human AMACR/p504S Recombinant Matched Antibody Pair - PBS only. 84891-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4005. 84891-6-PBS was HRP conjugated as the detection antibody. Range: 62.5-4000 pg/mL.

• 

  Sample test of MP01623-4

  The mean AMACR/p504S concentration was determined to be 2,611.4 pg/mL in LNCaP cell extract based on a 2.6 mg/mL extract load and 3,344.8 pg/mL in MCF-7 cell extract based on a 1.3 mg/mL extract load.

AMACR Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84891-6-PBS

Clone No.250503E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

p504S, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase, AMACR/p504S, EC:5.1.99.4

---

Product Information

84891-6-PBS targets AMACR as part of a matched antibody pair:

MP01623-4: 84891-7-PBS capture and 84891-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4005

  Product name: Recombinant Human AMACR protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 200-330 aa of NM_014324.6

  Sequence: KLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPL

• Full Name: alpha-methylacyl-CoA racemase
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_014324.6
• Gene Symbol: AMACR
• Gene ID (NCBI): 23600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHK6-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.