AMACR/p504S Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AMACR/p504S Recombinant monoclonal antibody (84891-8-RR)

• 

  WB analysis using 84891-8-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84891-8-RR (AMACR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of LNCaP using 84891-8-RR

  Immunofluorescent analysis of (4% PFA) fixed LNCaP cells using AMACR antibody (84891-8-RR, Clone: 250503G6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of DU 145 using 84891-8-RR

  Immunofluorescent analysis of (4% PFA) fixed DU 145 cells using AMACR antibody (84891-8-RR, Clone: 250503G6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84891-8-RR

  Biolayer interferometry (BLl) kinetic assays of 84891-8-RR against Human AMACR were performed. The affinity constant is 0.485 nM.

AMACR/p504S Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84891-8-RR

Clone No.250503G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

AMACR, p504S, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase, EC:5.1.99.4

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells, HEK-293 cells, LNCaP cells, DU 145 cells, NIH/3T3 cells, HSC-T6 cells
• Positive IF/ICC detected in: DU 145 cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84891-8-RR targets AMACR/p504S in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4005

  Product name: Recombinant Human AMACR/p504S protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 200-330 aa of NM_014324.6

  Sequence: KLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPL

• Full Name: alpha-methylacyl-CoA racemase
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_014324.6
• Gene Symbol: AMACR
• Gene ID (NCBI): 23600
• RRID: AB_3743817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHK6-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing and it can form a dimer of 70-75 kDa(PMID:21812041). Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).