Product Information
68401-1-PBS targets AMOTL2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19971 Product name: Recombinant human AMOTL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species |
| Full Name | angiomotin like 2 |
| Calculated Molecular Weight | 779 aa, 86 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC011454 |
| Gene Symbol | AMOTL2 |
| Gene ID (NCBI) | 51421 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y2J4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976)









