AMOTL2 Monoclonal antibody

• 

  WB analysis using 68401-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68401-1-Ig (AMOTL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of DU 145 using 68401-1-Ig

  DU 145 cells were subjected to SDS PAGE followed by western blot with 68401-1-Ig (AMOTL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Saos-2 using 68401-1-Ig

  Saos-2 cells were subjected to SDS PAGE followed by western blot with 68401-1-Ig (AMOTL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCI-H1299 using 68401-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 68401-1-Ig (AMOTL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 68401-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using AMOTL2 antibody (68401-1-Ig, Clone: 2C4A4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

AMOTL2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68401-1-Ig

Clone No.2C4A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

AMOTL2, angiomotin like 2, Angiomotin like protein 2, KIAA0989, LCCP, Leman coiled coil protein

---

Tested Applications

• Positive WB detected in: A549 cells, DU 145 cells, Saos-2 cells, NCI-H1299 cells, MDA-MB-468 cells, SK-BR-3 cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68401-1-Ig targets AMOTL2 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19971

  Product name: Recombinant human AMOTL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 340-466 aa of BC011454

  Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI

• Full Name: angiomotin like 2
• Calculated Molecular Weight: 779 aa, 86 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC011454
• Gene Symbol: AMOTL2
• Gene ID (NCBI): 51421
• RRID: AB_3085118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y2J4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976)