AMPK Alpha 1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AMPK Alpha 1 Monoclonal antibody (66536-1-Ig)

• Featured Product
• KD/KO Validated

AMPK Alpha 1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66536-1-Ig Copied!

Clone No. 1H8E1

Publications (118)

Reviews (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

PRKAA1, 1H8E1, 5'-AMP-activated protein kinase catalytic subunit alpha-1, AAPK1, ACACA kinase

• 

  WB analysis of HEK-293 using 66536-1-Ig

  WB result of AMPK alpha antibody (66536-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-AMPK alpha transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66536-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66536-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66536-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 66536-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66536-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66536-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66536-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66536-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 66536-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 66536-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AMPK Alpha 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, HEK-293 cells, A549 cells, HepG2 cells, K-562 cells, PC-12 cells, L02 cells, HT-29 cells, THP-1 cells, 4T1 cells, MCF-7 cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66536-1-Ig targets AMPK Alpha 1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, hamster, goat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24744

  Product name: Recombinant human AMPK alpha protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-207 aa of BC012622

  Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

• Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC012622
• Gene Symbol: AMPK Alpha 1
• Gene ID (NCBI): 5562
• RRID: AB_2881899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13131
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.

Publications

What published studies show

The AMPK Alpha 1 Monoclonal antibody (catalog number 66536-1-Ig) has 118 citations. These appear in journals including Cell Stem Cell, Cancer Research, Autophagy, ACS Nano, Redox Biology, Phytomedicine, International Journal of Molecular Sciences, Scientific Reports, and FASEB Journal. Research fields span oncology (breast, liver, colorectal, and lung cancers), metabolic disorders (obesity, diabetes, NAFLD), ferroptosis and autophagy, neurodegeneration (Alzheimer's disease), cardiovascular disease, and inflammation, with Western blot as the predominant application.

Automatically generated from the 118 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Stem Cell; Psychological stress drives aging-like hematopoietic stem cell dysfunction through a brain-gut-bone marrow axis.; Authors - Xiaobin Tian
human	WB	Cancer Res; ARID1A Stimulates Notch-TLL1 Signaling to Induce Cancer-Associated Fibroblast Activation and Intrahepatic Cholangiocarcinoma Development; Authors - Sheng Xu
human	WB	Cancer Res; MTHFD2 Enhances cMYC O-GlcNAcylation to Promote Sunitinib Resistance in Renal Cell Carcinoma; Authors - Jinwen Liu
human	WB	Drug Resist Updat; AMPKα2 attenuates doxorubicin induced ferroptosis by promoting NCOA4 degradation in triple negative breast cancer.; Authors - Xinjun Liu
mouse,human		Autophagy; PINK1-deficiency facilitates mitochondrial iron accumulation and colon tumorigenesis; Authors - Mariella Arcos
mouse	IHC	ACS Nano; Nutritional Glutamine-Modified Iron-Delivery System with Enhanced Endocytosis for Ferroptosis Therapy of Pancreatic Tumors; Authors - Yang Chen

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product (used at 1:5000 dilution on heart tissue for Western Blot) rates it 5 stars. The reviewer highlights high specificity, a strong and robust signal, low background, and consistent, reproducible results with good lot-to-lot consistency. Overall, the feedback is highly positive, indicating reliable performance for WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

YINGJIAN (Verified Customer) (08-15-2025)

high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: heart

AMPK Alpha 1 Antibody Western Blot validation (1:5000 dilution) in heart (Cat no:66536-1-Ig)