ANKRD13A Polyclonal antibody

• 

  WB analysis using 23998-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23998-1-AP (ANKRD13A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 23998-1-AP

  WB result of ANKRD13A antibody (23998-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ANKRD13A transfected HepG2 cells. The 100 kDa band may be a product of binding with ubiquitin.

• Featured Product
• KD/KO Validated

ANKRD13A Polyclonal Antibody for WB, ELISA

Cat No. 23998-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

Protein KE03, Ankyrin repeat domain-containing protein 13A, ANKRD13

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

23998-1-AP targets ANKRD13A in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21200

  Product name: Recombinant human ANKRD13A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-590 aa of BC032833

  Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK

• Full Name: ankyrin repeat domain 13A
• Calculated Molecular Weight: 590 aa, 68 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC032833
• Gene Symbol: ANKRD13A
• Gene ID (NCBI): 88455
• RRID: AB_2879397
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8IZ07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKRD13A, also named ANKRD13, a 590 amino acid protein, which contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A as ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	J Biol Chem; CYYR1 promotes the degradation of the E3 ubiquitin ligase WWP1 and is associated with favorable prognosis in breast cancer; Authors - Tiphaine Perron