Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IP | See 1 publications below |
Product Information
23998-1-AP targets ANKRD13A in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21200 Product name: Recombinant human ANKRD13A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 499-590 aa of BC032833 Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK Predict reactive species |
| Full Name | ankyrin repeat domain 13A |
| Calculated Molecular Weight | 590 aa, 68 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC032833 |
| Gene Symbol | ANKRD13A |
| Gene ID (NCBI) | 88455 |
| RRID | AB_2879397 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q8IZ07 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANKRD13A, also named ANKRD13, is a 590 amino acid protein that contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A is an ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, but does not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ANKRD13A antibody 23998-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



