ANKRD13A Recombinant monoclonal antibody

• 

  WB analysis using 87239-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87239-1-RR (ANKRD13A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 87239-1-RR

  HepG2 cells were subjected to SDS PAGE followed by western blot with 87239-1-RR (ANKRD13A antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

ANKRD13A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87239-1-RR

Clone No.251745E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ANKRD13, Ankyrin repeat domain-containing protein 13A, Protein KE03

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HepG2 cells, OVCAR-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87239-1-RR targets ANKRD13A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21200

  Product name: Recombinant human ANKRD13A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-590 aa of BC032833

  Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK

• Full Name: ankyrin repeat domain 13A
• Calculated Molecular Weight: 590 aa, 68 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC032833
• Gene Symbol: ANKRD13A
• Gene ID (NCBI): 88455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZ07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKRD13A, also named ANKRD13, is a 590 amino acid protein that contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A is an ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, but does not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane.