ANKRD13A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87239-1-RR (same clone as 87239-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87239-1-RR (ANKRD13A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87239-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 87239-1-RR (same clone as 87239-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 87239-1-RR (ANKRD13A antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87239-1-PBS in a different storage buffer formulation.

ANKRD13A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87239-1-PBS

Clone No.251745E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ANKRD13, Ankyrin repeat domain-containing protein 13A, Protein KE03

---

Product Information

87239-1-PBS targets ANKRD13A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21200

  Product name: Recombinant human ANKRD13A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-590 aa of BC032833

  Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK

• Full Name: ankyrin repeat domain 13A
• Calculated Molecular Weight: 590 aa, 68 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC032833
• Gene Symbol: ANKRD13A
• Gene ID (NCBI): 88455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZ07
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANKRD13A, also named ANKRD13, is a 590 amino acid protein that contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A is an ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, but does not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane.