Tested Applications
Positive WB detected in | mouse small intestine tissue |
Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25737-1-AP targets ANKRD13B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22732 Product name: Recombinant human ANKRD13B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 433-493 aa of BC032554 Sequence: FGNLNGCDEPVPSVRGSPSSETPSPGSDSSSVSSSSSTTSCRGCEISPALFEAPRGYSMMG Predict reactive species |
Full Name | ankyrin repeat domain 13B |
Calculated Molecular Weight | 626 aa, 70 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC032554 |
Gene Symbol | ANKRD13B |
Gene ID (NCBI) | 124930 |
RRID | AB_2880217 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86YJ7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANKRD13B (ankyrin repeat domain 13B) is an ubiquitin-binding protein belongs to the Ankrd 13 family. It specifically recognizes and binds 'Lys-63'-linked ubiquitin, and positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane (PMID: 22298428). This antibody specifically recognises the 70 kDa protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ANKRD13B antibody 25737-1-AP | Download protocol |
IHC protocol for ANKRD13B antibody 25737-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |