Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IP detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
23999-1-AP targets ANKRD29 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21201 Product name: Recombinant human ANKRD29 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 111-175 aa of BC030622 Sequence: DEGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPR Predict reactive species |
Full Name | ankyrin repeat domain 29 |
Calculated Molecular Weight | 301 aa, 33 kDa |
Observed Molecular Weight | 29 kDa |
GenBank Accession Number | BC030622 |
Gene Symbol | ANKRD29 |
Gene ID (NCBI) | 147463 |
RRID | AB_2879398 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q8N6D5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ANKRD29 antibody 23999-1-AP | Download protocol |
IP protocol for ANKRD29 antibody 23999-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |