Tested Applications
Positive WB detected in | mouse testis tissue, K-562 cells, PC-3 cells |
Positive IHC detected in | mouse testis tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25738-1-AP targets ANKRD54 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22759 Product name: Recombinant human ANKRD54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-300 aa of BC066909 Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR Predict reactive species |
Full Name | ankyrin repeat domain 54 |
Calculated Molecular Weight | 300 aa, 33 kDa |
Observed Molecular Weight | 33-35 kDa |
GenBank Accession Number | BC066909 |
Gene Symbol | ANKRD54 |
Gene ID (NCBI) | 129138 |
RRID | AB_2880218 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6NXT1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ANKRD54 antibody 25738-1-AP | Download protocol |
IHC protocol for ANKRD54 antibody 25738-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |