Anillin Monoclonal antibody, PBS Only

• 

  WB analysis using 66643-1-Ig (same clone as 66643-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66643-1-Ig (ANLN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66643-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66643-1-Ig (same clone as 66643-1-PBS)

  WB result of ANLN antibody (66643-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ANLN transfected MCF-7 cells. This data was developed using the same antibody clone with 66643-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66643-1-Ig (same clone as 66643-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66643-1-Ig (ANLN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66643-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66643-1-Ig (same clone as 66643-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66643-1-Ig (ANLN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66643-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 66643-1-Ig (same clone as 66643-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ANLN antibody (66643-1-Ig, Clone: 1B4A8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66643-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ANLN Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66643-1-PBS

Clone No.1B4A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Anillin, Scraps, scra, anillin, actin binding protein, Actin binding protein anillin

---

Product Information

66643-1-PBS targets ANLN in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19294

  Product name: Recombinant human ANLN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 818-1124 aa of BC034692

  Sequence: VCSTVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP

• Full Name: anillin, actin binding protein
• Calculated Molecular Weight: 1124 aa, 124 kDa
• Observed Molecular Weight: 110 kDa~120 kDa
• GenBank Accession Number: BC034692
• Gene Symbol: ANLN
• Gene ID (NCBI): 54443
• RRID: AB_2815000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NQW6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Anillin, an actin-binding protein, is a conserved cleavage furrow component important for cytokinesis. The human anillin protein localizes to the nucleus during interphase, the cortex following nuclear envelope breakdown, and the cleavage furrow during cytokinesis. It interactions with at least two other furrow proteins, actin and the septins through its C-terminal PH domain and N-terminal actin-binding domain. In anillin knockdown cells, the cleavage furrow ingressed but failed to complete the ingression. Anillin has been found to be overexpressed in tumors and may serve as promising marker for pancreatic carcinoma molecular diagnostics as well as a prognostic indicator for non-small cell lung cancers.